PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3AL_5EBB7439B.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 99aa    MW: 11467.2 Da    PI: 10.8899
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3AL_5EBB7439B.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.35.3e-11947442
                           XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1  4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeN 42
                            kr +r   NR +A+rsR RK+++i eLe+ v +L++e 
  Traes_3AL_5EBB7439B.1  9 PKRVKRILANRQSAQRSRVRKLQYISELERCVTTLQNEV 47
                           5999********************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.1E-14670IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.53860IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.06E-121064No hitNo description
PfamPF001703.6E-101054IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.2E-121064No hitNo description
CDDcd147032.41E-181162No hitNo description
PROSITE patternPS0003601328IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 99 aa     Download sequence    Send to blast
SSTETIRDPK RVKRILANRQ SAQRSRVRKL QYISELERCV TTLQNEVSVL SPRVAFLDQQ  60
RTILTVGNSH LKQRIAALAQ DKLFKDAHQE ALKEEIERL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1085531e-100AK108553.1 Oryza sativa Japonica Group cDNA clone:002-144-E08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569840.14e-64PREDICTED: basic leucine zipper 6-like
SwissprotQ5JMK62e-61BZP06_ORYSJ; Basic leucine zipper 6
TrEMBLW5CD561e-65W5CD56_WHEAT; Uncharacterized protein
TrEMBLM7ZPW02e-65M7ZPW0_TRIUA; Transcription factor VIP1
TrEMBLM0Y6Q98e-65M0Y6Q9_HORVD; Uncharacterized protein
STRINGMLOC_66252.12e-64(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.13e-52bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]